Skip to Content

ELISA Recombinant Haemophilus influenzae UPF0114 protein CGSHiGG_05795 (CGSHiGG_05795)

https://www.g4ldb.org/web/image/product.template/128488/image_1920?unique=45d657d
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Haemophilus influenzae (strain PittGG) Uniprot NO.:A5UH14 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKENKPVDPYAKYNEQSNIIAKIIFASRWLQVPIYLGLIVTLAIYSYKFIKGLWALVINV NDMDSNTImLGVLNLIDVVMIANLLVMVTIGGYEIFVSKLRTRNHPDQPEWMSHVNATVL KVKLSMSIIGISSIHmLQTFVNASNMPEKTMMWQLLLHLGFLVSAIALAYTDKILYSTSH KTH Protein Names:Recommended name: UPF0114 protein CGSHiGG_05795 Gene Names:Ordered Locus Names:CGSHiGG_05795 Expression Region:1-183 Sequence Info:fµLl length protein

1,528.00 € 1528.0 EUR 1,528.00 €

1,528.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days